Клінічні паралелі

Кальцитонін корисний для лікування хвороби Педжета, стану, за якого збільшена остеокластична активність спричинює компенсаторне утворення неорганізованої нової кістки. Він також має лікувальну дію у разі важкої гіпер-кальціємії, однак гормон треба вводити у вигляді ін’єкцій і його вплив зазвичай втрачається.

                                                                                                                                                                  

Підсумок

Тепер можна підсумувати дію трьох головних гормонів, що регулюють концентрацію Са2+ в плазмі. Паратгормон збільшує концентрацію кальцію в плазмі, мобілізуючи цей йон з кісток. Він збільшує реабсорбцію Са2+ нирками, однак це може бути наслідком зростання відфільтрованого Са2+, а також посилює утворення 1,25-дигідроксихолекальци-феролу, який підсилює абсорбцію Са2+ з кишки, мобілізує йон з кісток та збільшує реабсорбцію кальцію нирками. Кальцитонін пригнічує резорбцію кісток та збільшує кількість Са2+ в сечі.

                                                                                                                                                                  

ВПЛИВ ІНШИХ ГОРМОНІВ ТА ГУМОРАЛЬНИХ РЕЧОВИН НА МЕТАБОЛІЗМ КАЛЬЦІЮ

На метаболізм кальцію, окрім 1,25-дигідроксихолекаль-циферолу, паратгормону, пептиду, подібного до паратгор-мону, та кальцитоніну, впливає багато інших гормонів. Глюкокортикоїди знижують рівні Са2+ у плазмі, пригнічуючи утворення та активність остеокластів; унаслідок дії протягом тривалого часу зумовлюють остеопороз завдяки зменшенню утворення та збільшенню резорбції кісток. Вони зменшують утворення кістки шляхом пригнічення білкового синтезу в остеобластах, а також сповільнюють абсорбцію Са2+ та Р043 з кишки і збільшують ниркову екскрецію цих йонів. Саме тому вони пригнічують гіперкаль-ціємію в разі інтоксикації вітаміном D, зменшення концентрації Са2+ у плазмі стимулює секрецію паратгормону, який сприяє резорбції кістки.

Гормон росту зумовлює екскрецію кальцію в сечі, проте також підсилює кишкову абсорбцію кальцію, і ця дія може бути більшою, ніж вплив на екскрецію з підсумковим позитивним балансом кальцію.

ІФР-І, утворений дією гормону росту, стимулює білковий синтез у кістці. Як зазначено, тиреощні гормони можуть спричинити гіперкальціємію, гіперкальцинурію та, в деяких випадках, остеопороз.

Естрогени запобігають розвитку остеопорозу, можливо, шляхом безпосереднього впливу на остеобласти (див. вище).

Інсулін сприяє утворенню кістки, тому в разі неліко-ваного діабету простежується помітна втрата маси кісток.

Гіпофіз

22

ГІПОФІЗ

випадку з фактором росту, печінкою чи іншими тканинами (див. нижче). Крім того, передня частка гіпофіза виділяє (3-ліпотропін (р-ЛПГ). Цей одношаровий поліпептид має

Вступ

Передню, проміжну і задню частки гіпофіза можна вважати сукупністю окремих ендокринних органів, які у представників деяких видів тварин містять 14 чи більше гормонально активних речовин. У людини проміжна частка є рудиментом. Виявлено шість гормонів, що їх секретує передня частка гіпофіза: тиреотропний гормон (ТТГ, ти-ротропін), адренокортикотропний гормон (АКТГ), лютеїнізувальний гормон (ЛГ), фолікулостимулюваль-ний (ФСГ), пролактин і гормон росту (табл. 22-1). АКТГ, пролактин і гормон росту — це прості поліпептиди чи білки, тоді як ТТГ, ЛГ, ФСГ є глікопротеїнами. Пролактин діє на молочну залозу. Згадані п’ять гормонів певною мірою троп-ні, тобто вони стимулюють виділення гормонально активних речовин іншими ендокринними залозами або, як у

91 залишок амінокислот і, хоча його фізіологічна роль точно не відома, містить послідовності амінокислот, які є в структурі ендорфінів та енкефалінів — пептидів, що зв’язуються із опіатними рецепторами (див. Розділ 4). Передня і проміжна частки містять також інші гормонально активні похідні молекули проопіомеланокортину (див. нижче). Гормони, тропні до кожної ендокринної залози, розглянуто в інших розділах: ТТГ — у Розділі 18; АКТГ — у Розділі 20: гонадотропіни ФСГ і ЛГ та пролактин — у Розділі 23. Гормони (окситоцин і вазопресин), що їх виділяє задня частка гіпофіза у ссавців, та нервове регулювання секреції передньої і задньої часток гіпофіза описані у Розділі 14. Гормон росту, Р-ліпотропін і меланотропні гормони (МТГ) проміжної частки гіпофіза а-МТГ та Р-МТГ є темою цього розділу поряд із загальними відомостями про гіпофіз.

Таблиця 22-1. Гормони гіпофіза у ссавців1

Назва і джерело

Основна дія

Передня частка

Тиреотропний гормон (ТТГ, тиротропін)

Стимулює виділення гормонів щитоподібною залозою та її ріст

Адренокортикотропний гормон (АКТГ, кортикотропін)

Стимулює секрецію і ріст пучкової та сітчастої зон кори надниркових залоз

Гормон росту (ГР, соматотропін, СТГ)

Прискорює ріст тіла; стимулює виділення інсуліноподібного фактора росту 1 (ІФР-І)

Фолікулостимулювальний гормон (ФСГ)

Стимулює ріст фолікула в яєчнику у жінок та сперматогенез у чоловіків

Лютеїнізувальний гормон (ЛГ)

Стимулює овуляцію та лютеїнізацію оваріальних фолікулів у жінок та виділення тестостерону у чоловіків

Пролактин (ПРЛ)

Стимулює виділення молока і поведінку матері

p-Ліпотропін (Р-ЛПГ)

?

у-Меланотропний гормон (у-МТГ)

Див. Проміжна частка

Проміжна частка

а-, р-, у-Меланотропні гормони (а-, р-, у-МТГ; загальна назва меланотропін, чи інтермедин)

Проліферація меланофорних клітин у риб, амфібій та рептилій; стимулює синтез меланіну меланоцитами у людей в серці

у-Ліпотропін (у-ЛПГ), кортикотропіноподібний пептид проміжної частки (КППП), інші фрагменти проопіомеланокортину

?

Задня частка

Вазопресин (антидіуретичний гормон, АДГ)

Сприяє затримуванню рідини

Окситоцин

Зумовлює виділення молока, скорочення матки вагітних

1 Крім того, різні шлунково-кишкові та інші поліпептиди виявлені в одній чи кількох частках гіпофіза: холецистокінін (ХЦК), гастрин, ренін, ангіотензин II, пептид, споріднений з геном кальцитоніну (ПСГК).

                                                                                                                                                                  

МОРФОЛОГІЯ Загальна анатомія

Анатомія гіпофіза показана на рис. 22-1 і детально описана у Розділі 14. Задня частка гіпофіза утворена більше з закінчень кровоносних судин аксонів із супраоптичного та паравентрикулярного ядер гіпоталамуса, тоді як передня має спеціальний судинний зв’язок з головним мозком через портальні гіпофізарні судини. Проміжна частка формується під час ембріонального розвитку із дорсальної частини кишені Ратке вип’ячуванням верхньої стінки глотки, однак тісно зростається із задньою часткою у дорослих. Вона відділена від передньої частки рештками кишені Ратке і залишковою щілиною.

ГІСТОЛОГІЯ

У задній частці закінчення супраоптичних та паравен-трикулярних аксонів розміщені поблизу кровоносних судин. У деяких видів ці закінчення мають вигляд віникопо-дібних структур. Розрізняють також пітуїтоцити — зірчасті клітини, що містять кульки жиру; раніше вважали, що вони виділяють гормони задньої частки, а сьогодні їх трактують як модифіковану астроглію.

Проміжна частка є рудиментом у людей та інших представників ссавців: у них більшість клітин аґранулярні, хоча часто трапляються базофільні елементи, що є клітинами передньої частки. Вздовж залишкової щілини розміщені маленькі тиреоїдоподібні фолікули, деякі містять незначну кількість колоїду Функція колоїду досі невідома.

Передня частка гіпофіза побудована із переплетених клітинних тяжів і розгалуженої сітки синусоїдних капілярів. Ендотелій капілярів фенестрований і нагадує ендотелій інших ендокринних органів. Клітини містять гранули із накопиченим гормоном, які відходять з клітини шляхом екзоцитозу. Проникнення гранул у капіляри не виявлено, тому, ймовірно, що вони розпадаються у перикапілярній зоні.

                                                                                                                                                                  

Типи клітин передньої частки гіпофіза

Клітини передньої частки гіпофіза людини традиційно поділяють за реакціями їхнього забарвлення на хромофобні тахромофільні. Відповідно, хромофільні клітини бувають

Третій шлуночок Третій шлуночок

Рис. 22-1. Схема формування гіпофіза та різних його частин у дорослих.

ацидофільними, що їх забарвлюють кислі барвники, і базо-фільними, що їх забарвлюють лужні барвники. Багато хро-мофобних клітин є секреторними, вони неактивні і містять незначну кількість секреторних гранул. Інші клітини — це зірчасті (фолікулярні) (див нижче). За допомогою імуно-цитохімічних і електронно-мікроскопічних методів виявлено п’ять типів секреторних клітин, а саме: соматотропні, які виділяють гормон росту; лактотропні (їх називають також мамотропними), які виділяють пролактин; тирео-тропні, що виділяють ТТГ; гонадотропні, що виділяють ЛГ та ФСГ; кортикотропні, які виділяють АКТГ і Р-ЛПГ. Характеристики цих клітин наведені у табл. 22-2. їхня поява та вміст Гранул можуть змінюватися зі змінами гормонального статусу. Зазначимо, що відповідно до цієї класифікації два чи більше поліпептидних гормонів можуть бути виділені декількома типами клітин.

Передня частка гіпофіза містить також зірчасті клітини, які утворюють відростки між секреторними клітинами. Доведено, що ці клітини містять і виділяють цитокін інтер-лейкін 6 (ІЛ-6) (див. Розділ 27), однак їхня фізіологічна роль невизначена.

                                                                                                                                                                  

Двосубодинична структура ФСГ, ЛГ, ТТГ

Усі три гіпофізарні глікопротеїнові гормони ФСГ, ЛГ, ТТГ утворені з двох субодиниць. Кожна субодиниця — їх позначено а і Р — має певну активність, однак для прояву максимальної фізіологічної дії вони повинні об’єднатися. Крім того, у плацентарному глікопротеїні — хоріонічному гонадотропіні людини (ХГл) — також є а- і р-субодиниці (див. Розділ 23). Усі а-субодиниці цих гормонів — продукти одного гена, у них однаковий амінокислотний склад, проте різні залишки вуглеводів. Бета-субодиниці, що їх продукують різні гени, відрізняються за структурою і надають гормону специфічності. Альфа-субодиниці надзвичайно взаємозамінні, тому, як наслідок, можуть утворюватися гібридні молекули. Фізіологічне й еволюційне значення унікальної двосубодиничної структури цих глікопротеїнових гормонів недостатньо вивчене.

                                                                                                                                                                  

ГОРМОНИ ПРОМІЖНОЇ ЧАСТКИ Проопіомеланокортин

Клітини проміжної і кортикотропоцити передньої часток синтезують великий білок-попередник, унаслідок розщеплення якого виникає група гормонів. Після видалення сигнального пептиду утворюється прогормон, відомий як проопіомеланокортин (ПОМК). Синтезування цієї молекули відбувається також у гіпоталамусі та інших частинах нервової системи, легенях, шлунково-кишковому тракті і плаценті (див. Розділ 4). Структуру молекули зображено на рис. 22-2. У кортикотропоцитах цей прогормон гідролізує до АКТГ, Р-ЛПГ і невеликої кількості Р-ендорфіну, після чого ці субстанції виділяються. У проміжній частці ПОМК далі гідролізує до кортикотропіно-подібного пептиду проміжної частки (КППП), у-ЛПГ і значної кількості Р-ендорфіну. Функції КППП і у-ЛПГ невідомі, а Р-ендорфін є опіоїдним пептидом (див. Розділ

4), має п’ять амінокислотних залишків метенкефаліну з його N-кінця у людини. Утворюються також а- і Р-МТГ.

ГІПОФІЗ / 365

Таблиця 22-2. Гормоносекретувальні клітини передньої частки гіпофіза у людини

Тип клітин

Гормони, які виділяють

% від загальної кількості секреторних клітин

Здатність до забарвлення

Діаметр секреторних ґранул, нм

Соматотропні

Гормон росту

50

Ацидофільні

300-400

Лактотропні

Пролактин

10-30

Ацидофільні

200

Кортикотропні

АКТГ, р-ЛПГ

10

Базофільні

400-550

Тиреотропні

ТТГ

5

Базофільні

120-200

Г онадотропні

ФСГ, ЛГ

20

Базофільні

250-400

Проміжна частка є рудиментом, і в дорослих а- чи р-МТГ інколи не виділяються.

                                                                                                                                                                  

Контроль за піґментацією шкіри

Риби, рептилії та амфібії змінюють колір шкіри для терморегулювання, маскування та підтримання реакцій поведінки. Вони це роблять завдяки руху чорних чи коричневих гранул до чи з периферії пігментних клітин, які називають меланофорами. Ґранули утворені з меланіну, що синтезується з ДОФА (див. Розділ 4) і ДОФА-хінону. Рух Гранул контролюють різні гормони і нейротрансмітери, у тім числі ос- і р-МТГ, меланіноконцентрувальний гормон, мелатонін і катехоламіни.

У ссавців немає меланофорів із пігментними гранулами, які поширюються й аґрегують, однак є меланоцити, що мають меланосоми і синтезують меланіни. Меланоцити пере

носять далі меланосоми до клітин шкіри (кератиноцитів) та волосяних фолікулів. Це причина пігментації волосся і шкіри. Меланоцити мають рецептори до меланотропіну 1, одного із декількох типів рецепторів меланотропіну, які кло-новано. Лікування з використанням МТГ посилює синтезування меланіну і зумовлює ледь видиме потемніння шкіри людей протягом 24 год. Як зазначено вище, ос- і Р-МТГ не циркулюють у дорослих людей, і їхня функція невідома. АКТГ зв’язується із рецепторами до меланотропіну 1.

                                                                                                                                                                  

Порушення піґментації у людини

Зміни піґментації у разі деяких ендокринних захворювань спричинені змінами у циркулюванні АКТГ. Наприклад, ненормальна блідість є ознакою гіпопітуїтаризму. Гі-перпіґментація виникає у пацієнтів із недостатністю кори надниркових залоз внаслідок захворювання надниркових

Т»

н

Г

~1

т

о>

Е>

О)

(Л О)

—І

<

<

<

<

6)

6)

(/)

<0 6)

со

1—

>

<

<

_|

_|

-1 <

—І

Сигнальний

пептид

(-131)

у- МТГ (-55 до-44)

Фрагмент амінозакінчення

АКТГ (1-39) р-ЛПГ (42-134) |пЧ і ПрЧ

АКТГ

р-лпг

|пЧіПрЧ

у-МТГ

^Тільки ПрЧ

І Швидко в ПрЧ І Повільно в ПЧ

а-МТГ КППП у-ЛПГ р-Ендорфін

(1-13) (18-39) (42-101) (104-134)

Р-МТГ Метенкефалін (84-101) (104-108)

Рис. 22-2. Схематичне зображення молекули препроопіомеланокортину, що утворюється в клітинах гіпофіза, нейронах та інших тканинах. Номери в дужках означають послідовність амінокислот у кожному поліпептидному фрагменті. Для зручності амінокислотні послідовності пронумеровані від N-кінця АКТГ і читаються до С-кінця батьківської молекули, тоді як амінокислотна послідовність іншої частини молекули — наліво до -131, в N-кінець батьківської молекули. Розташування Lys-Arg та інших пар головних амінокислотних залишків також показано; це ділянки протеолітичного розщеплення в разі утворення менших фрагментів батьківської молекули; ПЧ — передня частка; ПрЧ — проміжна частка.

залоз. Справді, наявність гіперпіґментації у поєднанні з недостатністю кори надниркових залоз свідчить про те, що недостатність є вторинною стосовно до хвороби гіпофіза чи гіпоталамуса, оскільки в разі цих станів АКТГ у плазмі не є підвищеним (див. Розділ 20).

Альбіноси мають вроджену неспроможність синтезувати меланін. Альбінізм виникає у людей та багатьох інших видів ссавців. Він може бути спричинений різними генетичними дефектами на шляху синтезу меланіну. У випадку неповного альбінізму виникають плями на шкірі, що пов’язано зі зменшенням меланіну внаслідок вроджених дефектів у міграції попередників пігментної клітини із нервового валика під час ембріонального розвитку. Не тільки стан, а й точний характер втрати пігментації передається з покоління в покоління. Вітиліго — захворювання, спричинене подібною втратою меланіну, — виникає після народження і прогресує упродовж життя.

                                                                                                                                                                  

ГОРМОН РОСТУ Біосинтез і хімія

Довге плече 17-ї хромосоми людини містить кластер гормону росту — хоріонічного соматомамотропіну людини (ХСл) з п’яти генів: перший, ГРл-Н (нормальний), кодує

найпоширенішу форму гормону росту; другий, ГРл-В (варіантний), — іншу форму гормону росту (див. нижче); два кодують ХСл (див. Розділ 23), а п’ятий, імовірно, ХСл, є псевдогеном.

Нормальний гормон росту людини — це продукт ГРл-Н, він становить 75% усіх молекул ГРл, що циркулюють. Завдяки молекулярній масі — 22 000 він відомий також як 22 К ГРл. На рис. 22-3 показано його структуру, яку порівняно зі структурою ГРл, що також має 191 амінокислотний залишок і відрізняється тільки за 29 залишками. Ген ГРл-В, який первинно виділяється у плаценті, продукує 191-амінокислотний гормон росту, що відрізняється від нормального людського гормону росту 13 амінокислотами, розкиданими по поліпептидному ланцюгу. Помітна кількість гормону простежується в циркуляції лише під час вагітності. Матрична РНК, яку продукує ген ГРл-Н, підлягає альтернативному сплайсингу з утворенням гормону росту, ідентичного до 22 К ГРл, за винятком делегованих амінокислотних залишків 32-46. Менша форма — 20 К ГРл — також є біологічно активною і становить близько 10% гормону росту, що циркулює. Фізіологічне значення наявності двох основних форм — 22 К і 20 К — невідоме. Крім того, в кров’яному руслі виявлені дезаміновані та різні інші форми, що свідчить про множинність типів гормону росту в організмі.

Рис. 22-3. Структура головної форми гормону росту людини (неперервний ланцюг). Темними проміжками позначені дисульфідні мостики; 29 залишків уздовж ланцюга визначають залишки, які відрізняються у хоріонічному соматомамотропіні людини (ХСл; див. Розділ 23). Усі інші залишки у ХСл є такими самими, і ХСл також має 191 амінокислотний залишок.

ГІПОФІЗ / 367

                                                                                                                                                                  

Видова специфічність

Виявлено значні відмінності у структурі гормону росту між різними видами. Гормон росту, що виділяється у свині і хом’ячка, має короткочасну дію у морської свинки, можливо тому, що він стимулює швидке утворення антитіл до гормону росту. У мавп і людини гормон росту бика і свині не має навіть значного короткочасного впливу на ріст. Хоча мавп’ячий і людський гормони росту, повністю активні, виявлено як у мавпи, так і в людини. Гормон росту людини має також лактогенну активність.

                                                                                                                                                                  

Концентрації у плазмі, зв’язування і метаболізм

Гормон росту пов’язаний з білком плазми, що є великим фрагментом позаклітинного домену рецептора гормону росту (див. нижче). Він виникає внаслідок розщеплення рецепторів у людини, його концентрація є показником кількості рецепторів гормону росту у тканинах. Близько половини активного гормону росту перебуває у зв’язаній формі, що є джерелом гормону для компенсації широкомасштабних коливань під час його секреції (див. нижче).

Гормон росту швидко розщеплюється, принаймні частково, у печінці. Період півжиття гормону росту, що цирку

лює, у людини становить 6-20 хв. З’ясовано, що добове виведення гормону росту у дорослих — 0,2-1,0 мг/добу.

У нормі базальний рівень гормону росту в плазмі дорослої людини, визначений радіоімунологічним методом, -менше 3 нг/мл. Він головно представлений 22 К ГРл, оскільки спорідненість 20 К ГРл для більшості антитіл становить близько 30% від спорідненості 22 К ГРл. Білок-зв’язану і вільну форми гормону визначають радіоімунологічним методом, оскільки антитіла, які використовують для цього, мають більшу спорідненість до гормону, ніж до зв’язувальних білків.

                                                                                                                                                                  

Рецептори гормону росту

Рецептором гормону росту є білок, що складається з 620 амінокислот, має велику позаклітинну частину, трансмембранний домен і велику цитоплазматичну частину. Він належить до надродини цитокінових рецепторів, розглянутих у Розділі 27.

Гормон росту має дві ділянки зв’язування з рецептором, і коли він зв’язується з однією субодиницею рецептора, то інша зв’язувальна ділянка притягує іншу субодиницю, утворюючи гомодимер (рис. 22-4). Димеризація є в основі активування рецептора.

Рис. 22-4. Головні сигнальні шляхи, активовані димеризацією рецептора фактора росту (РФР). Підтверджені реакції впливу гормону росту позначені суцільними стрілками і забарвленими молекулами. Штрихові стрілки і незабарвлені молекули відображають ефекти, зумовлені факторами росту, однак поки що не виявлені для гормону росту. Детальніше шлях від Grb2 до МАР К та ФЛС-шлях розглянуто у Розділі 1; GLE-1, GLE-2 — елементи інтерферон у-активованої відповіді; СІР — субстрат інсулінового рецептора; p90RSK — S6 кіназа; ФГ^ — фосфоліпаза SIE — Sis-індукований елемент; ЕСВ — елемент сироваткової відповіді; ФСВ — фактор сироваткової відповіді; TCF — фактор четвертинного комплексу. Гени, активовані у випадку C-fos (див. Розділ 1): Р450-ЗА10 — цитохром; Spi 2.1 — інгібітор серинової протеази (модифіковано за дозволом з Argetsinger LS, Carter-Sy С: Mechaism of signalling by growth hormone receptor. Physiol Rev 1996;76:1089)..

Гормон росту виконує багато функцій в організмі (див. нижче). Хоча поки що неможливо визначити кореляцію між його внутрішньоклітинним впливом і дією на весь організм, та відомо, що, як і інсулін, він активує різноманітні внутрішньоклітинні ензимні каскади (див. рис. 22-4). Потрібно зазначити про активування гормоном росту JAK2-Stat шляху. JAK2 є представником родини Janus, до якої належать цитоплазматичні тирозинові кінази. Білки Stat (провідники сигналів і активатори транскрипції) належать до родини цитоплазматичних факторів транскрипції, які після фосфорилювання JAK кіназами мігрують до ядра й активують різні гени. JAK-Stat шлях також опосередковує дію пролактину та різних факторів росту.

                                                                                                                                                                  

Вплив на ріст

У молодих тварин, у яких епіфізи ще не злилися з довгими кістками (див. Розділ 23), ріст пригнічує гіпофізек-томія (рис. 22-5), а стимулює гормон росту. Хондрогенез у цьому випадку прискорений, і оскільки хрящові епіфізіаль-ні пластинки розширюються, то вони відкладають більше кісткового матриксу на кінцях довгих кісток (рис. 22-6). Унаслідок цього розміри тіла збільшуються, тому довготривале лікування гормоном росту призводить до гігантизму.

Якщо епіфізи закриті, то лінійний ріст стає неможливим, а гормон росту спричинює характерну деформацію кісток і м’яких тканин, відому у людини як акромегалія (рис. 22-7). Розміри більшості внутрішніх органів у цьому разі збільшені. Ендокринні органи можуть також підпадати під вплив гормону росту, який діє синергічно з АКТГ, спричинюючи збільшення розмірів надниркових залоз, та з

Рис. 22-5. Вплив гіпофізектомії на ріст незрілої резус мавпи. Два роки тому обидві мавпи мали однаковий зріст і масу, пізніше тварині ліворуч було виконано гіпофізектомію (відтворено за дозволом з Knobil Е in Growth in Living Systems. Zarrow MX [editor]. Basic Books, 1961).

Рис. 22-6. Вплив лікування гормоном росту упродовж чотирьох днів на проксимальні епіфізи гомілкової кістки щурів після епіфізектомії. Простежується збільшення ширини незабарв-леної хрящової пластинки великогомілкової кістки у лікованої тварини праворуч (для порівняння ліворуч наведено контроль) (відтворено за дозволом з Evans НМ et al: Bioassay of pituitary growth hormone. Endocrinology 1943;32:14).

андрогенами, зумовлюючи збільшення додаткових репродуктивних органів. Вміст білка в організмі за цих умов збільшується, а вміст жиру зменшується.

                                                                                                                                                                  

Вплив на метаболізм білків та електролітів

Гормон росту є анаболічним гормоном для білків, він забезпечує позитивний баланс азоту та фосфору, збільшення вмісту фосфору у плазмі і зменшення вмісту сечовин-

Зміни полів зору

ГІПОФІЗ / 369

ного азоту та амінокислот у крові. У дорослих із його недостатністю створений за рекомбінантною технологією гормон росту людини спричинює збільшення маси тіла і зменшення кількості жиру поряд зі зростанням метаболічної активності і зниженням рівня холестеролу в плазмі крові. Одночасно посилюється всмоктування кальцію у шлунково-кишковому тракті. Екскреція натрію і калію пригнічена незалежно від впливу надниркових залоз, імовірно тому, що ці електроліти переходять з нирок до тканин, що ростуть. Під час росту і в разі акромегалії, а також багатьох інших захворювань посилюється екскреція амінокислоти

4-гідроксипроліну. Більша частина виділеного гідрокси-проліну походить з колагену, тому екскреція гідроксипро-ліну збільшується у випадку захворювань, пов’язаних з активним руйнуванням колагену. Цей процес також посилюється під час активного синтезування розчинного колагену, що його стимулює саме гормон росту.

                                                                                                                                                                  

Вплив на метаболізм вуглеводів і жирів

Вплив гормону росту на метаболізм вуглеводів розглянуто у Розділі 19. Гормон росту має діабетогенну дію, оскільки підвищує виділення печінкової глюкози і виявляє антиінсуліновий ефект у м’язах. Він також має кетогенну дію, оскільки підвищує рівень вільних жирних кислот (ВЖК), що циркулюють у крові. Збільшення ВЖК, що виникає через декілька годин, є джерелом енергії для тканин під час гіпоглікемії, голодування чи стресу. Гормон росту прямо не стимулює В-клітини підшлункової залози, однак посилює здатність цієї залози реагувати на інсуліно-генні подразники, такі як аргінін чи глюкоза. Це додаткове свідчення того, як названий гормон сприяє росту, оскільки інсулін має анаболічний ефект щодо білків (див. Розділ 19).

                                                                                                                                                                  

Соматомедини

Вплив гормону росту на ріст, хрящову тканину та метаболізм білків залежить від взаємодії між цим гормоном і соматомединами, які є поліпептидними факторами росту, що їх виділяє печінка й інші тканини. Перший виділений такий фактор названо фактором сульфатації, оскільки він стимулює проникнення сульфату у хрящову тканину. Однак згодом з’ясували, що він також стимулює утворення колагену, тому назву змінено на соматомедин. Крім того, сьо

годні відомо велику різноманітність соматомединів; вони є членами великої родини факторів росту, які впливають на різні тканини й органи.

Головними (а у людини, ймовірно, єдиними) соматомединами, що циркулюють, є інсуліноподібний фактор росту І (ІФР-І, соматомедин С) та інсуліноподібний фактор росту II (ІФР-ІІ). Ці фактори дуже подібні до інсуліну, однак у їхньому складі є С-ланцюги (рис. 22-8) і продовжений А-ланцюг, який ще називають D-доменом. Гормон релаксин (див. Розділ 23) теж член цієї родини. У людини розрізняють дві споріднені форми релаксину; обидві вони подібні до ІФР-ІІ. Варіантна форма ІФР-І, на N-кінці якої нема залишків трьох амінокислот, виявлена у головному мозку людини; є також декілька варіантних форм людського ІФР-ІІ (рис. 22-9). Матричну РНК ІФР-І, ІФР-ІІ знайдено в печінці, хрящовій і багатьох інших тканинах, що свідчить про їхній синтез у цих тканинах.

Властивості ІФР-І, ІФР-ІІ та інсуліну наведено у табл. 22-3. Обидва фактори тісно пов’язані з конкретними білками плазми крові, що продовжує період півжиття фактора у кровообігу. Виявлено шість ІФР-зв’язувальних білків з різним поширенням у тканинах. Вони всі містяться в плазмі, причому ІФР-зв’язувальний білок-3 (ІФРЗБ-З) забезпечує 95% зв’язування ІФР у кровоплині. Внесок ІФР в інсуліноподібну активність у крові розглянуто у Розділі 19. Рецептор ІФР-І дуже подібний до інсулінових рецепторів і, вірогідно, використовує такі самі внутрішньоклітинні механізми дії. Рецептор ІФР-ІІ є рецептором манозо-6-фосфату (див. рис. 19-6), що задіяний у внутрішньоклітинному прикладенні кислої гідролази та інших білків до внутрішньоклітинних органел. Секреція ІФР-І не залежить від гормону росту до народження, однак стимульована ним після народження і має помітну ростостимулювальну активність. Його концентрація в плазмі крові збільшується в дитячому віці, досягає максимального рівня під час статевого дозрівання і спадає до низького рівня у старечому віці. ІФР-ІІ значно менше підпадає під вплив гормону росту і відіграє роль у рості плоду до народження. У людського плоду з надмірною експресією цього фактора непропорційно ростуть органи, зокрема, язик, м’язи, нирки, серце і печінка. У дорослих ген ІФР-ІІ експресується тільки у хоріоїдальному сплетенні і мозкових оболонках.

В С A D

ІФР-І GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRT.EMYCAPLKPAKSA ІФР-ІІ AYRPSETLCGGELVDTLQFVCGDRGFYFSRPA- — SRVSRRSR- -GIVEECCFRSCDLALLETYCAT- — PARSE Інсулін FVNQHLGGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCN

Рис. 22-8. Будова ІФР-І, ІФР-ІІ та інсуліну людини із вишикуваними в ряд амінокислотними залишками для демонстрації гомологічних, які позначені кольоровими ділянками. Коди з однієї букви використані для амінокислотних залишків. Зазначимо, що в інсуліні С-пептиду нема, тоді як у ІФР-І, ІФР-ІІ А- і В-ланцюги (домени) зв’язані С-пептидом. Крім того, є TD-домени (модифіковано і відтворено за дозволом з Sara VR, Hall К: Insulin-like growth factors and their binding proteins Physiol Rev 1990;70:591).

Таблиця 22-3. Порівняння інсуліну та інсуліноподібних факторів росту

Інсулін

ІФР-І

ІФР-ІІ

Інші назви

Соматомедин С

Активність, що стимулює поділ клітин

Кількість амінокислот

51

70

67

Джерело

В-клітини підшлункової залози

Печінка та інші тканини

Різні тканини

Концентрація регульована

Глюкозою

Гормоном росту, харчуванням

Невідомо

Концентрація у плазмі

0,3-2,0 нг/мл

10-700 нг/мл максимальна у період пубертату

300-800 нг/мл

Зв’язувальний білок плазми

Ні

Так

Так

Головна фізіологічна дія

Регулювання метаболізму

Ріст кісткової і хрящової тканин

Ріст під час внутрішньоутроб-ного розвитку

                                                                                                                                                                  

Безпосередня та опосередкована дія гормону росту

Інтерпретації механізмів впливу гормону росту змінювались, аж доки не отримали нових даних. Початково вважали, що гормон росту зумовлює ріст, безпосередньо діючи на тканини, згодом — винятково через посередництво соматомединів. Проте якщо гормон росту ввести в один із проксимальних великогомілкових епіфізів, то виникає однобічне збільшення ширини хряща, оскільки хрящ, як і інші тканини, виробляє ІФР-І. Недавно запропоновано гіпотезу, що пояснює такі наслідки дії гормону росту на хрящ шляхом перетворення стовбурових клітин у клітини, які відповідають на вплив ІФР-І. Після цього ІФР-І, який виробляється локально і потрапляє в кровообіг, зумовлює ріст хряща.

Рис. 22-9. Первинна структура людського ІФР-І І і трьох виявлених варіантів; продовження з 21-го залишка амінокислоти на карбоксильному кінці; тетрапептидна заміна Ser-29 і три-пептидна заміна Ser-ЗЗ. Коди з одної букви використані для амінокислотних залишків (відтворено за дозволом з Sara VR, Hall К: Insulin-like growth factors and their binding proteins Physiol Rev 1990;70:591).

Значення ІФР-І, що циркулюють, є важливим, оскільки введення ІФР-І щурам після гіпофізектомії відновлює ріст кісток і тіла.

На рис. 22-10 підсумовано сучасні погляди на дію гормону росту та ІФР-І. Гормон росту, ймовірно, діє спільно з циркулювальними і локально продукованими ІФР-І, зумовлюючи принаймні деякі з названих ефектів.

                                                                                                                                                                  

Вільям Ф. Ґанонґ. Фізіологія людини