Ендокринна функція нирок, серця та епіфіза

                                                                      

ВСТУП

Крім гіпофіза, щитоподібної, паращитоподібних та підшлункової залоз, наднирників і гонад, до органів з ендокринною функцією належить чимало інших структур організму. Гормони, що стимулюють чи пригнічують секрецію гормонів передньої частки гіпофіза, секретовані гіпоталамусом (див. Розділ 14); крім того, велику кількість гормонів виробляє слизова шлунково-кишкового тракту (див. Розділ 26). Багато різноманітних клітин продукують цитокіни, інтерлейкіни і фактори росту (див. Розділи 1, 22 та 27). Нирки виробляють три гормони: 1,25-дигідроксихоле-кальциферол (див. Розділ 21), ренін та еритропоетин. Натрійуретичні пептиди — це речовини, що їх продукує серце та інші тканини. Вони збільшують екскрецію натрію нирками, а надлишкова їхня кількість інгібує ензим Na»-К+-АТФ-азу. Епіфіз секретує мелатонін — це індол, який теж може мати ендокринну функцію. В цьому розділі розглянуто ендокринну функцію нирок, серця та епіфіза.

                                                                                                                                                                  

РЕНІН-АНГІОТЕНЗИНОВА СИСТЕМА Ренін

Відомо, що у разі парентерального введення екстрактів ниркової тканини підвищується артеріальний тиск. Це відбувається завдяки реніну — ензиму з групи кислих протеаз, що його секретують нирки безпосередньо у кров. Ренін діє у комплексі з ангіотензиноперетворювальним ензимом, утворюючи ангіотензин II (рис. 24-1). Ангіотензин II -це глікопротеїн, молекулярна маса якого у людини становить 37 326. Його молекула складається з двох часток, або доменів, у глибокій щілині між якими розміщений активний центр. В активному центрі суміщені два залишки аспарагінової кислоти; один у 104 позиції, інший у 292 (номери залишків амінокислот у препрореніні людини). Вони відіграють важливу роль в активності цього ензиму. Отже, ренін належить до аспартилових протеаз.

Подібно до інших гормонів, ренін синтезується у вигляді великого препрогормону. Препроренін людини містить 406 амінокислотних залишків. Проренін, що утворюється внаслідок від’єднання від препрореніну початкової послідовності з 23 амінокислот, містить 383 амінокислотні залишки. Відповідно, після від’єднання від прореніну так

званої пропослідовності амінокислот формується активний ренін, що містить 340 амінокислотних залишків. Біологічної активності проренін практично не має. Деяка його кількість перетворюється в нирках у ренін, а решта -секретується. Проренін секретують також інші органи, зокрема яєчники. Після нефректомії рівень прореніну у крові, що циркулює, знижується незначно і може, фактично, навіть підвищитися, однак рівень активного реніну знижується практично до нуля. Отже, лише дуже незначна кількість прореніну в крові перетворюється у ренін, а активний ренін є продуктом переважно, якщо не винятково, нирок. Проренін секретується в багатьох тканинах організму, тоді як активний ренін утворюється переважно в секреторних гранулах юкстагломерулярних клітин (див. нижче).

Період напівжиття активного реніну в крові, що циркулює, становить до 80 хв. Єдиною відомою сьогодні його функцією є відщеплення ангіотензину І від амінового кінця декапептиду ангіотензиногену (субстрату реніну).

                                                                                                                                                                  

Ангіотензиноген

Ангіотензиноген, що циркулює, виявлено в а2-фракції глобулінів плазми (див. рис. 24-1). Він містить близько 13% вуглеводів і складається з 453 амінокислотних залишків; синтезується в печінці з сигнальною послідовністю із 32 амінокислотних залишків, яка відокремлюється в ендоплазматичній сітці. Глюкокортикоїди, тиреоїдні гормони, естрогени, деякі цитокіни й ангіотензин II підвищують його рівень у крові, що циркулює.

                                                                                                                                                                  

Ангіотензиноперетворювальний ензим і ангіотензин II

Ангіотензиноперетворювальний ензим (АЛЕ) — це

дипептидилкарбоксипептидаза, яка відщеплює гістидин-лейцин від фізіологічно неактивного ангіотензину І, утворюючи октапептид ангіотензин II (рис. 24-2). Той самий ензим інактивує брадикінін (див. Розділ 31). Більша частина перетворювального ензиму, що утворює ангіотензин II у крові, міститься в ендотеліальних клітинах. Перетворення відбувається головно під час проходження крові через легені, однак також і в багатьох інших ділянках організму.

АПЕ — це ектоензим, у якому наявні дві форми — соматична, що є по всьому організму, і термінальна, що міститься лише в постмейотичних сперматогенних тканинах

ЕНДОКРИННА ФУНКЦІЯ НИРОК, СЕРЦЯ ТА ЕПІФІЗА / 417

метаболіти

Рис. 24-1. Утворення і метаболізм ангіотензинів, що циркулюють у крові.

і сперматозоїдах (див. Розділ 23). Обидві форми АПЕ мають єдиний трансмембранний домен і короткий цитоплазматичний “хвіст”. Однак соматичний АПЕ є білком з молекулярною масою 170 кДа і двома гомологічними позаклітинними доменами, кожен з яких містить активний центр (рис. 24-3). Термінальний АПЕ має молекулярну масу 90 кДа, лише один позаклітинний домен і один активний центр. Обидва ензими утворюються з одного гена. Однак цей ген має два різні промоутери, які утворюють дві різні мРНК. У мишей чоловічої статі з вилученим геном АПЕ артеріальний тиск нижчий від нормального, а в таких же мишей жіночої статі він нормальний. Крім того, у мишей чоловічої статі в цьому разі знижується плідність, чого не простежується у мишей жіночої статі.

                                                                                                                                                                  

Метаболізм ангіотензину II

Ангіотензин II метаболізує швидко, період його напів-життя в крові людини становить 1-2 хв. Його розщеплюють різноманітні пептидази. Амінопептидаза відщеплює залишок аспарагіну від амінового кінця пептиду. Гептапеп-тид, що утворюється внаслідок цього, має фізіологічну активність; деколи його називають ангіотензином III (див. нижче). Відщеплення другої кінцевої амінокислоти від ангіотензину III приводить до утворення гексапептиду -ангіотензину IV, якому, ймовірно, також притаманна деяка активність. Більшість інших пептидних фрагментів неактивна. Крім того, амінопептидаза може впливати на ангіотензин І, унаслідок чого утворюється (des-Asp ^-ангіотензин І, здатний перетворюватись безпосередньо в ангіотензин III під впливом АПЕ. Здатність метаболізувати

Asp-Arg-Val-Tyr-lle-His-Pro-Phe-His-Leu-Val-lle-His-R

t

Ренін розщеплює цей зв’язок

>■ Ангіотензиноген

Asp-Arg-Val-Tyr-lle-His-Pro-Phe-His-Leu

t

АПЕ розщеплює цей зв’язок

Ангіотензин І

Asp-Arg-Val-Tyr-lle-His-Pro-Phe

t

Амінопептидаза розщеплює цей зв’язок

Ангіотензин II

Ангіотензин III

Рис. 24-2. Структура амінного кінця ангіотензиногену й ангіотензинів I, II та III у людини; R — залишок білка. Після відщеплення лідерної послідовності з 24 амінокислот ангіотензиноген містить 453 амінокислотні залишки. Структура ангіотензину II у собак, щурів та багатьох інших ссавців ідентична до структури у людини. Ангіотензин II у корів і овець у 5-й позиції замість ізолейцину містить валін.

Позаклітинне

поширення

Zn2+ zn2+ ~

Каталітичний сайт Каталітичний сайт

амінового кінця карбоксилового кінця

NH2

Трансмембранний домен

Внутрішньоклітинне

поширення

СООН

Рис. 24-3. Схематичне зображення структури соматичної форми ангіотензиноперетворювального ензиму. Зверніть увагу на короткий ендоплазматичний “хвіст” молекули та два позаклітинні каталітичні сайти, кожен з яких зв’язується з йоном цинку (Zn2+). (Відтворено за дозволом з Johnston СІ: Tissue angiotensin-converting enzyme in cardiac and vascular hypertrophy, repair and remodeling. Hypertension 1994;23:258).

ангютензин мають еритроцити та інші тканини організму. Вилучення ангіотензину II з кровообігу відбувається, ймовірно, за допомогою деякого механізму захоплення, який діє в капілярних ложах різних тканин (за винятком легень).

Рівень реніну, як звичайно, вимірюють шляхом інкубації зразка, який піддають аналізу, і визначенням за допомогою імунохімічного аналізу кількості утвореного ангіотензину І. Таким способом визначають ренінову активність плазми (РАП) зразка. РАП може знижуватись не лише зі зменшенням кількості реніну, а й у разі дефіциту ангіотензино-гену, що може призвести до неправильної інтерпретації результатів дослідження. Щоб уникнути цього, до зразка часто додають екзогенний ангіотензиноген; у цьому випадку визначають концентрацію реніну в плазмі (КРП), а не РАП. В осіб, що одержують з їжею нормальну кількість натрію, нормальне значення РАП у горизонтальному положенні становить близько 1 нг ангіотензину І на 1 мл зразка за 1 год. Концентрація ангіотензину II в плазмі крові у таких людей становить близько 25 пг/мл (близько 25 пмоль/л).

                                                                                                                                                                  

Дія ангіотензинів

Ангіотензин І діє винятково як попередник ангіотензину II і не має жодної іншої відомої сьогодні функції. Ангіотензин II, який попередньо називали гіпертензином, або ангіотоніном, зумовлює звуження артеріальних судин і підвищення систолічного і діастолічного тиску крові. Це один з найпотужніших відомих вазоконстрикторів, який у нормальних осіб виявляє у 4—8 разів більшу активність, ніж норадреналін. Однак його пресорна активність послаблюється в осіб з вираженою нестачею натрію і в хворих на цироз печінки та деякі інші захворювання. За цих станів

рівень ангіотензину II в крові, що циркулює, підвищується, і за механізмом негативного зворотного зв’язку відбувається пригнічення ангіотензинових рецепторів у гладкій мускулатурі судинної стінки. Цим же пояснюють той факт, що ангіотензин II, уведений ззовні, зумовлює менш виражений ефект, ніж ендогенний.

Ангіотензин II діє безпосередньо на кору надниркових залоз, збільшуючи секрецію альдостерону. Отже, головною регулювальною ланкою секреції альдостерону є ренін-ангіотензинова система (див. Розділ 20). До додаткових ефектів ангіотензину II належать полегшене вивільнення норадреналіну шляхом прямої дії на постгангліонарні симпатичні нейрони, скорочення мезангіальних клітин, яке супроводжується значним зменшенням швидкості клубоч-кової фільтрації (див. Розділ 38), а також безпосередня дія на систему ниркових канальців, що спричинює збільшення реабсорбції натрію.

Крім того, ангіотензин II впливає на мозок, знижуючи поріг чутливості барорефлексу (див. Розділ 31), а це потенціює пресорний ефект ангіотензину II. Він також діє на мозок, посилюючи відчуття спраги (див. Розділ 14) і збільшуючи секрецію вазопресину і АКТГ. Ангіотензин II не проникає через гематоенцефалічний бар’єр, однак впливає, діючи на навколошлуночкові органи — чотири невеликого розміру структури, що містяться поза гематоенцефалічним бар’єром (див. Розділ 32). Одна з цих структур, так звана area postrema, відповідає передусім за потенціацію пресор-ного впливу, тоді як дві інші (субфорнікальний орган (СФО) і судинний орган кінцевої пластинки (СОКП)) — за збільшене відчуття спраги (дипсогенний ефект). Проте сьогодні не визначено, які з навколошлуночкових органів відповідають за підвищення секреції вазопресину й АКТГ.

Ангіотензин III [(des-Aspl)-aHrioTeH3HH II] має лише близько 40% пресорної активності ангіотензину II, проте 100% його альдостероностимулювальної дії. Різні дослідники припускали, що ангіотензин III є природним аль-достероностимулювальним пептидом, тоді як ангіотензин II регулює артеріальний тиск. Однак насправді ангіотензин ІП — це просто продукт розпаду з притаманною йому деякою біологічною активністю. Це ж стосується й ангіотензину IV, хоча деякі дослідники вважають, що він має деякий унікальний вплив на мозок.

                                                                                                                                                                  

Тканинні ренін-ангіотензинові системи

Крім системи, яка продукує ангіотензин II у крові, що циркулює, багато інших тканин містять незалежні ренін-ангіотензинові системи, які генерують ангіотензин II, напевно, для місцевої дії. Компоненти ренін-ангіотензи-нової системи містяться у стінці кровоносних судин, матці, плаценті та оболонках плоду. Високу концентрацію про-реніну зафіксовано в амніотичній рідині. Крім того, ренін-ангіотензинова система або принаймні деякі її компоненти є в очних яблуках, екзокринній частині підшлункової залози, серці, жировій тканині, корі надниркових залоз, яєчках, яєчниках, передній та середній частках гіпофіза, епіфізі та мозку. Функції цих тканинних ренін-ангіотензи-нових систем ще не з’ясовані, хоча з’являється щораз більше доказів того, що ангіотензин II — це один з вирішальних факторів росту серцевої тканини і кровоносних судин. Тканинний ренін потрапляє у кровообіг лише у мізерних кіль

ЕНДОКРИННА ФУНКЦІЯ НИРОК, СЕРЦЯ ТА ЕПІФІЗА / 419

костях, тому після двобічного видалення нирок активність реніну плазми знижується до рівня, який сучасними методами не виявляють.

                                                                                                                                                                  

Рецептори ангіотензину II

Є принаймні два класи рецепторів ангіотензину II (див. рис. 24-1). Рецептори ATj — це ангіотензинові рецептори плазунів, які за допомогою G-білка (білок Gq) з’єднуються з фосфоліпазою С, після чого ангіотензин II підвищує рівень вільного Са2+ в цитозолі. Він також активує численні ензими групи тирозинових кіназ. У гладких м’язах судинної стінки ATj-рецептори з’єднуються з ямками на поверхні клітини (див. Розділ 1); у цьому разі ангіотензин II збільшує утворення кавеоліну 1 — однієї з трьох ізоформ білка, який є специфічним для клітинних ямок. У гризунів є два відмінні, однак тісно пов’язані підтипи АТ^-АТ^ і AT , кодовані двома окремими генами. Підтип АТ виявляють у стінках кровоносних судин, мозку і багатьох інших органах. Він є трансмітером більшої частини відомих ефектів ангіотензину II. Рецептор АТ виявляють у передній частці гіпофіза і в корі надниркових залоз. У людини ген АТ^рецептора є в 3-й хромосомі. Відомі докази наявності й другого типу ATt-рецепторів, однак ще не вирішено, чи у людини справді є такі ж окремі підтипи ангіо-тензинових рецепторів, як АТ і АТш.

Наявні також АТ2-рецептори, які у людини кодовані геном, що розташований в Х-хромосомі. Як і AT ^рецептори, вони мають сім трансмембранних доменів, однак виконують цілком інші функції: діють через G-білок, активуючи різноманітні фосфатази, які, відповідно, діють як антагоністи факторів росту і відкривають К+-канали. Крім цього, активування АТ2-рецепторів збільшує утворення NO і, отже, підвищує внутрішньоклітинний вміст цГМФ.

Загальні фізіологічні наслідки цих вторинних месен-джерних ефектів сьогодні ще нез’ясовані. У плоду і новонародженого є значно більше АТ2-рецепторів, проте їх виявлено й у дорослих — у мозку та в деяких інших органах.

Регулювання AT}-рецепторів в артеріолах і AT ^рецепторів у корі надниркових залоз відбувається протилежним способом: надлишок ангіотензину II впливає на судинні рецептори за механізмом негативного зворотного зв’язку, однак на рецептори в корі надниркових залоз — за механізмом позитивного зворотного зв’язку, що робить цю залозу чутливішою до альдостероностимулювальних ефектів цього пептиду.

                                                                                                                                                                  

Юкстагломерулярний апарат

Ренін, що міститься в екстрактах нирки і судинному руслі, продукують юкстагломерулярні клітини (ЮГ-клітини). Ці епітеліальні клітини розташовані між аферентних артеріол у місці їхнього входження в клубочок (рис. 24-4). Вони містять секреторні пухирці, які є резервуаром реніну. Ренін також виявляють в аґранулярних клітинах, які заповнюють ділянку з’єднання між аферентними та еферентними артеріолами, однак його функція в цьому місці невідома.

У проміжку, де аферентна артеріола входить у клубочок, а еферентна покидає його, канадець нефрону дотикається до артеріол клубочка, з якого походить. У цьому місці, яке позначає початок дистального покрученого канальця, є ділянка зміненого канальцевого епітелію, яку називають щільною плямою (див. рис. 24-4). Щільна пляма розміщена в безпосередній близькості до ЮГ-клітин. Мезан-гіальні, ЮГ-клітини, і щільна пляма утворюють юкстагломерулярний апарат.

Рис. 24-4. Ліворуч: схематичне зображення клубочка з юкстагломерулярним апаратом. Праворуч: фазова контрастна мікроскопія аферентної артеріоли у незабарвленому замороженому препараті нирки миші. Зверніть увагу на еритроцит у просвіті артеріоли і ґранульовані юкстагломерулярні клітини в стінці судини (з дозволу С РеіІ).

                                                                                                                                                                  

Регулювання секреції реніну

На секрецію реніну впливають багато різноманітних чинників (табл. 24-1), у будь-який момент часу вона залежить від сумарної активності цих чинників. Одним з важливих чинників є внутрішньонирковий барорецепторний механізм, що зменшує секрецію реніну у випадку, коли тиск в артеріолах на рівні ЮГ-клітин підвищується, і збільшує її, коли він знижується. Іншим сенсорним механізмом регулювання секреції реніну є щільна пляма: рівень секреції реніну обернено пропорційний до швидкості транспортування Na+ і С1“ через цю ділянку канальця. Швидкість транспортування залежить не лише від активності щільної плями, а й від кількості електролітів, що досягають її. Отже, зменшене надходження Na+ і С1“ до дистальних канальців пов’язане зі збільшенням секреції реніну. Простагландини, особливо простациклін (див. Розділ 17), стимулюють секрецію реніну, очевидно, безпосередньо впливаючи на ЮГ-клітини. Є деякі докази того, що трансмітер, через який клітини щільної плями впливають на секрецію реніну, — це N0 (див. Розділ 31). Рівень секреції реніну зворотно залежить від концентрації К+ в плазмі крові, однак вплив К+, ймовірно, опосередкований змінами надходження Na+ і СІ” до клітин щільної плями.

Ангіотензин II за механізмом зворотного зв’язку пригнічує секрецію реніну шляхом прямої дії на ЮГ-клітини. Вазопресин також пригнічує секрецію реніну in vitro і in vivo, хоча досі нез’ясовано, є його ефект in vivo прямим чи опосередкованим.

Нарешті, посилення активності симпатичної нервової системи також підвищує секрецію реніну. Цей ефект пов’язаний зі збільшенням концентрації катехоламінів у крові і впливом норадреналіну, секретованого постгангліонарни-ми симпатичними нервами нирки. Катехоламіни діють найбільше на Р,-адренергічні рецептори ЮГ-клітин. Зростання внутрішньоклітинної концентрації збільшує секрецію реніну.

Головні стани, що супроводжуються збільшенням секреції реніну у людини, наведені в табл. 24-2. У більшості випадків центральний венозний тиск знижується і це призводить до збільшення симпатичної активності, що потенційно може призвести до зниження тиску в ниркових артеріолах. Звуження ниркової артерії й аорти в ділянці прокси-мальніше до ниркових артерій призводить до зниження тиску в ниркових артеріолах. Психологічні подразники збільшують активність ниркових нервів.

Таблиця 24-1. Чинники, що впливають на секрецію реніну Стимулювальні

Посилення симпатичної активності ниркових нервів Збільшення концентрації катехоламінів у крові Простагландини Інгібіторні

Збільшення реабсорбції Na+ і СІ» у щільній плямі Збільшення тиску в аферентній артеріолі Ангіотензин II Вазопресин

                                                                                                                                                                  

Фармакологічний вплив на ренін-ангіотензинову систему

Сьогодні вплив реніну можна пригнічувати багатьма різними способами. Інгібітори синтезу простагландинів, такі як індометацин і Р-адреноблокатори (пропранолол), можуть знижувати секрецію реніну.

Пептид пепстатин і нещодавно розроблені інгібітори реніну, наприклад, препарат еналкірен, перешкоджають реніну утворювати ангіотензин І. Інгібітори ангіотензино-перетворювального ензиму, такі як каптоприл і енала-прилл попереджають перетворення ангіотензину І в ангіотензин II. Саралазин і деякі інші аналоги ангіотензину II є конкурувальними інгібіторами дії ангіотензину II як на AT,-, так і на АТ2-рецептори. Лозартан (DuP-753) селективно блокує AT,-рецептори, a PD-123177 та деякі інші медикаментозні середники селективно блокують АТ2-ре-цептори.

                                                                                                                                                                  

Роль реніну в розвитку артеріальної гіпертензії

Звуження однієї ниркової артерії зумовлює раптове збільшення секреції реніну і розвиток стабільної гіпертензії (ниркова гіпертензія, або гіпертензія Ґольдблатта). Видалення ішемізованої нирки або усунення артеріальної обструкції усуває гіпертензію, якщо вона не була тривалою. Загалом гіпертензія, спричинена обструкцією однієї ниркової артерії в разі інтактної іншої нирки (див. табл. 33-5), супроводжується збільшенням концентрації реніну в крові, що циркулює. Клінічним відповідником цього стану є ниркова гіпертензія внаслідок атеросклеротичного ураження ниркової артерії та інші аномалії ниркового кровообігу. Однак активність реніну плазми за однобічної оклюзії, як звичайно, є в межах норми.

Причини гіпертензії за цих обставин невідомі. У багатьох пацієнтів, що страждають на гіпертонічну хворобу, інгібітори АПЕ і лозартан дають добрий гіпотензивний ефект навіть тоді, коли нирковий кровоплин нормальний, а активність реніну плазми нормальна або навіть знижена.

Роль реніну в механізмі зворотного зв’язку, що допомагає підтримувати сталість об’єму позаклітинної рідини шляхом регулювання секреції альдостерону, описана в Розділі 20. Високий рівень секреції реніну відповідає за посилення секреції альдостерону (вторинний гіпераль-достеронізм), що простежується у деяких нормотензивних пацієнтів з цирозом печінки і нефрозом.

Таблиця 24-2. Стани, у яких збільшується секреція реніну

Дефіцит Na+

Діуретики

Гіпотензія

Кровотечі

Вертикальне положення тіла Дегідратація Серцева недостатність Цироз печінки

Стеноз ниркової артерії або аорти Різноманітні психологічні подразники

ЕНДОКРИННА ФУНКЦІЯ НИРОК, СЕРЦЯ ТА ЕПІФІЗА / 421

                                                                                                                                                                  

ЕРИТРОПОЕТИН Структура і функція

Якщо людина втрачає кров або перебуває в стані гіпоксії, то синтез гемоглобіну посилюється, продукування і вивільнення еритроцитів з кісткового мозку (еритропоез) значно збільшуються (див. Розділ 27). Натомість якщо кількість еритроцитів збільшується понад норму у разі гемотрансфузій, то еритропоетична активність кісткового мозку послаблюється. Ці явища є наслідком зміни вмісту в крові еритропоетину, циркулювального глікопротеїну, який містить 165 амінокислотних залишків і чотири оліго-сахаридні ланцюги, необхідні для його активності in vivo. Рівень еритропоетину значно підвищується у разі анемії (рис. 24-5).

Еритропоетин збільшує кількість еритропоетиночутли-вих активованих стовбурових клітин у кістковому мозку, які перетворюються у попередники еритроцитів, а згодом — у зрілі еритроцити (див. рис. 27-2). Рецептор до еритропоетину є лінійним білком з одним трансмембранним доменом, який належить до надродини цитокінових рецепторів (див. Розділ 1). Він має тирозинкіназну активність і активує каскад серинових та треонінових кіназ, стимулюючи ріст і диференціацію клітин-мішеней. Коли рівень еритропоетину знижується, то в еритроїдних стовбурових клітинах відбувається розпад ДНК, за яким настає програмована загибель клітин (апоптоз). Апоптоз клітин різного типу, як відомо, — це складова частина нормального розвитку багатьох тканин. Еритропоетин же знижує інтенсивність розпаду ДНК в еритроїдних стовбурових клітинах і сприяє їхньому виживанню.

Гематокрит

Рис. 24-5. Концентрація еритропоетину в плазмі здорових донорів крові (трикутники) й пацієнтів з різними формами анемії (квадрати) (відтворено за дозволом з Erslev AJ: Erythro-petin. N Engl J Med 1991 ;324:1339).

Головним місцем інактивації еритропоетину є печінка. Тривалість періоду напівжиття еритропоетину в крові становить близько 5 год. Однак збільшення кількості еритроцитів у судинному руслі під впливом еритропоетину виявляється лише через два-три дні, оскільки дозрівання еритроцитів — це порівняно повільний процес. Втрата навіть невеликого фрагмента залишків сіалової кислоти у вуглеводній частині молекули еритропоетину зменшує період його напівжиття до 5 хв, що робить його біологічно неефективним.

                                                                                                                                                                  

Джерела еритропоетину

У дорослих близько 85% еритропоетину виробляють нирки і 15% — печінка. Обидва ці органи містять мРНК для синтезування еритропоетину. Еритропоетин може також екстрагуватися з селезінки і слинних залоз, однак ці тканини не містять відповідної мРНК, отже, не здатні продукувати гормона.

Під час ембріонального розвитку та в перші дні життя головним органом еритропоезу є печінка, вона ж — головне місце синтезування еритропоетину, перш ніж функцію еритропоезу візьме на себе кістковий мозок, а продукування еритропоетину — нирки. Якщо кількість повноцінної ниркової тканини у дорослих зменшується внаслідок нефректомії або захворювань нирок, то печінка вже не в стані компенсувати дефіцит еритропоетину, і часто виникає анемія.

У дорослих еритропоетин продукують інтерстиційні клітини в перитубулярних капілярних ложах нирки і пери-венозні гепатоцити печінки.

Ген, що відповідає за синтезування цього гормону, кло-новано. Рекомбінантний еритропоетин, який продукують клітини тварин, застосовують у клінічній практиці як препарат епоетин-альфа. Він дуже цінний у лікуванні анемії на ґрунті ниркової недостатності.

У 90% пацієнтів на термінальній стадії ниркової недостатності, які перебувають на гемодіалізі, є виражена анемія внаслідок дефіциту еритропоетину. Крім того, еритропоетин застосовують для стимулювання кровотворення в осіб, які здають власну кров, готуючись до авто-гемотрансфузії під час планових хірургічних втручань (див. Розділ 27).

                                                                                                                                                                  

Регулювання секреції еритропоетину

Як звичайно, секрецію еритропоетину стимулює гіпоксія, однак її також можуть посилювати солі кобальту й андрогени.

Дослідження останніх років свідчать, що сенсорною системою, яка регулює продукування еритропоетину залежно від вмісту 02 в крові, є гемовий білок, який у діоксиформі стимулює, а в оксиформі пригнічує транскрипцію гена еритропоетину, а отже, утворення еритропое-тинової мРНК. Секрецію гормону полегшує алкалоз, який розвивається на значних висотах.

Подібно до секреції реніну, секрецію еритропоетину посилюють катехоламіни через p-адренергічний механізм, хоча ренін-ангіотензинова система цілком відокремлена від еритропоетинової. Продукування еритропоетину стимулює аденозин та інгібує антагоніст аденозину — теофілін.

                                                                                                                                                                  

ГОРМОНИ СЕРЦЯ ТА ІНШІ НАТРІЙУРЕТИЧНІ ФАКТОРИ

                                                                                                                                                                  

Структура

Наявність різноманітних натрійуретичних гормонів визнана лише недавно. Два з них секретує серце. М’язові клітини в передсердях і менше у шлуночках містять секреторні гранули (рис. 24-6), кількість яких збільшується зі збільшенням приймання натрію хлориду й об’єму позаклітинної рідини. Екстракти тканини передсердя здатні посилювати виділення натрію з сечею.

Першим натрійуретичним гормоном, виділеним з серця, був передсердний натрійуретичний пептид (ANP -від нагл. artial natriuretic peptide) поліпептид з характерним кільцем із 17 амінокислот, утвореним за допомогою дисуль-фідного зв’язку між двома залишками цистеїну. Циркулю-вальна форма цього поліпептиду містить 28 амінокислотних залишків (рис. 24-7). Вона утворена з великої пре-курсорної молекули, яка містить 151 амінокислотний залишок, у тім числі сигнальний пептид, що складається з 24 амінокислот. ANP згодом виділено з інших тканин, зокрема мозку, де він є в двох формах, менших за розмірами, ніж ANP у судинному руслі.

Другий натрійуретичний пептид виділено з мозку свині, його назвали мозковий натрійуретичний пептид (BNP — від англ. brain natriuretic peptide). У людини він також є в мозку, однак більше виявляється в серці, у тім числі його шлуночках. Форма цього гормону, що циркулює у крові, містить 32 амінокислотні залишки і має таке ж кільце з 17 амінокислот, як і ANP, хоча деякі з цих амінокислот відмінні від тих, що їх містить аналогічне кільце ANP (див. рис. 24-7). Третього члена цієї родини названо натрійуре- * 1

Рис.24-6. Ґранули ANP (д), розсіяні між мітохондріями (т) щура в м’язових клітинах передсердя; G — апарат Ґольджі; N — ядро. Ґранули у клітинах передсердь людини мають подібний вигляд. х17 640 (з дозволу М Cartin).

тичний пептид С-типу (CNP — від англ. C-type natriuretic peptide), оскільки він був третім з виділених (тому позначений третьою літерою латинського алфавіту). Він містить

22 амінокислотні залишки (див. рис. 24-7), однак є й більша його форма, що складається з 53 амінокислот. CNP наявний у мозку, гіпофізі, нирках і клітинах ендотелію судин. Проте його кількість у тканинах серця і кров’яному руслі дуже мала; він, імовірно, передусім відіграє роль паракринного трансмітера.

1 і-1 28

ANP SLRRSSCFGGRMDRIGAQSGLGCNSFRY

1 і-1 32

BNP SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

1 і-122

CNP GLSKGCFGLKLDRIGSMSGLGC

Рис. 24-7. ANP, BNP та CNP у людини. Вгорі: односимвольні коди амінокислотних залишків, де показано спільні амінокислотні послідовності (позначені кольором). Унизу: форма молекул. Зверніть увагу, що термінальним залишком на карбоксильному кінці CNP є цистеїн; таким способом карбоксильний кінець цього поліпептидного ланцюга замикається, утворюючи 17-членне кільце (модифіковано з Imura Н, Nakao К, Itoh Н: The natriuretic peptide system in the brain: Implication in the central control of cardiovascular and neuroendocrine functions. Front Neurondocrinol 1992; 13:217).

ЕНДОКРИННА ФУНКЦІЯ НИРОК, СЕРЦЯ ТА ЕПІФІЗА / 423

                                                                                                                                                                  

Функція

Гормони ANP і BNP, що містяться в крові, діють на нирки, збільшуючи екскрецію Na+; уведений ін’єкційним способом CNP теж дає подібний ефект. Імовірно, вони впливають шляхом дилатації аферентних артеріол і релаксації мезангіальних клітин. Обидва ці ефекти посилюють фільтрування у клубочках (див. Розділ 38), а також діють на ниркові канальці, пригнічуючи реабсорбцію Na+. До інших ефектів належить збільшення проникності капілярів, що призводить до екстравазації рідини і зниження артеріального тиску. Крім того, вони сприяють розслабленню гладком’язових елементів в артеріолах і венулах. CNP має більше виражений судинорозширювальний вплив на вени, ніж ANP і BNP. Ці пептиди також знижують секрецію реніну і протидіють пресорним ефектам катехоламінів та ангіо-тензину II.

У мозку ANP наявний у нейронах. Нервовий провідниковий шлях, що містить ANP, тягнеться від антеромеді-альної частини гіпоталамуса до ділянок стовбура мозку, які відповідають за нервове регулювання серцево-судинної системи.

Загалом дія ANP на мозок протилежна до впливу ангіо-тензину II, і нервові волокна, що містять ANP, найімовірніше, відповідають за зниження артеріального тиску і посилене виділення натрію з сечею. Значення CNP і BNP для мозку, мабуть, таке ж , як і ANP, однак детальнішої інформації з цього приводу ще не отримано.

                                                                                                                                                                  

Рецептори натрійуретичних пептидів

Сьогодні виявлено й описано три різні типи рецепторів натрійуретичних пептидів (NPR) (рис. 24-8). Двоє з цих рецепторів — NPR-А і NPR-B — разом перетинають клітинну мембрану і мають цитоплазматичні домени, які за хімічною суттю є гуанілатциклазами. Гормон ANP найбільше споріднений з рецептором NPR-A, a CNP — з NPR-В. Третій рецептор — NPR-C — зв’язується з усіма трьома натрійуре-тичними пептидами, проте має помітно усічений цитоплазматичний домен. Є деякі докази, що він діє через G-білки, активуючи фосфоліпазу С і пригнічуючи аденілатциклазу. Однак дискусійне твердження, що цей рецептор не є пуско

NPR-A

ПКР_

Мембрана клітиниД Цитоплазма

Домен

гуанілат-

циклази

NPR-B

NPR-C

Рис. 24-8. Схематичне зображення рецепторів до натрійуре-тичного пептиду. Молекули NPR-А і NPR-B містять внутрішньоклітинні гуанілатцикпазні домени, тоді як кліренсний рецептор NPR-C має лише один невеликий цитоплазматичний домен.

вою точкою жодних внутрішньоклітинних процесів, а лише так званий кліренсний рецептор, який просто зв’язує натрійуретичні пептиди, що циркулюють у крові, і вивільнює їх згодом, що допомагає підтримувати сталість концентрації цих гормонів у крові.

                                                                                                                                                                  

Секреція і метаболізм

Концентрація ANP у плазмі крові в осіб, що споживають помірну кількість натрію, становить у нормі близько 5 фмоль/мл. Секреція ANP збільшується тоді, коли об’єм ПКР збільшується внаслідок довенного введення ізотонічного розчину натрію хлориду або дієти з високим вмістом натрію, а також у разі занурення у воду до шиї (рис. 24-9) (ця процедура протидіє впливові сили земного тяжіння на

Час, год

Рис. 24-9. Вплив занурення у воду до рівня шиї на концентрацію в плазмі крові ANP і альдостерону та активність плазмового реніну (PRA) (модифіковано і відтворено за дозволом з Epstein М et al: Increases in circulating atrial natriuretic factor during immersion-induced central hypervolaemia in normal humans. Hypertension 1986;4 [Suppl 2]:593).

кровообіг, збільшуючи центральний венозний тиск, і як наслідок — тиск у передсердях). Зазначимо, що занурення у воду також зменшує секрецію реніну й альдостерону Натомість унаслідок переходу з положення лежачи у положення стоячи рівень ANP у плазмі крові незначно знижується, однак піддається реєстрації в поєднанні зі зниженням центрального венозного тиску In vitro смужки передсерд-ної м’язової тканини вивільнюють ANP у разі їхнього штучного розтягнення. Отже, ймовірно, що передсердя in vivo безпосередньо відповідають на розтяг, а інтенсивність секреції ANP пропорційна до того ступеня, на який передсердя розтягуються в разі підвищення центрального венозного тиску.

ANP у крові, що циркулює, має короткий період півжиття. Його метаболізує нейтральна ендопептидаза (НЕП), яку пригнічує триптофан. Отже, приймання триптофану збільшує рівень ANP у крові.

Значно менше відомо про секретування тканинами серця BNP та його метаболізм, проте вони, швидше всього, подібні до відповідних процесів з ANP.

                                                                                                                                                                  

Фактор інгібування Ма++-АТФ-ази

У крові є й інший натрійуретичний фактор, який стимулює виділення натрію з сечею шляхом інгубування ензиму Na+-K+-ATO-a3H і більше схильний підвищувати артеріальний тиск, аніж знижувати його. Недавні дослідження засвідчили, що ця речовина — оубаїн, стероїд із дигіталісо-подібним ефектом, який синтезується в надниркових залозах. Однак його фізіологічне значення ще не з’ясоване.

                                                                                                                                                                  

ЕПІФІЗ

Епіфізу (шишкоподібній залозі), яку Декарт уважав вмістищем душі, колись приписували безліч різноманітних функцій. Сьогодні відомо, що він секретує мелатонін, і найімовірнішою його функцією є роль внутрішнього годинника, що синхронізує зміни стану організму з циклічними змінами світлої і темної частини доби.

                                                                                                                                                                  

Анатомія

Епіфіз розвивається з даху третього шлуночка під заднім кінцем мозолистого тіла і за допомогою корінця зв’язується із задньою та повідцевою спайками. В корінці є нервові волокна, однак вони не досягають залози. Епіфізарна строма містить нейроглію і паренхіматозні клітини, що свідчить про її секреторну функцію (рис. 24-10). Подібно до інших залоз внутрішньої секреції, епіфіз має надзвичайно проникні фенестровані капіляри. У молодих тварин і немовлят шишкоподібна залоза великих розмірів, і її клітини мають тенденцію об’єднуватись в альвеоли. Перед початком періоду статевого дозрівання починається інволюція епіфіза, і в людини у тканині залози формуються невеличкі каменеподібні скупчення фосфату й карбонату кальцію (“епіфізарний пісок”). Оскільки ці конкременти є рентгенконтрастними, то нормальна шишкоподібна залоза часто візуалізується на рентгенограмах черепа дорослих осіб. Зміщення кальцифікованого епіфіза порівняно з його нормальним положенням свідчить про наявність об’ємного утвору, наприклад, пухлини мозку.

Рис. 24-10. Ліворуч: сагітальний розріз стовбура мозку людини, на якому показано епіфіз та його іннервацію. Ретиногіпоталамічні волокна утворюють синапси в надперехресному ядрі спинного мозку. Прегангліонарні нейрони йдуть від спинного мозку до верхнього шийного вузла, а постгангліонарні — від цього вузла до епіфіза у складі вінцевих нервів. Праворуч: гістологічна будова епіфіза. Малюнок тканинного препарату, забарвленого гематоксилінеозином (відтворено за дозволом з Fawcett DW: Bloom and Fawcett, A Textbook of Histology, 11 ed. Saunders, 1986).

ЕНДОКРИННА ФУНКЦІЯ НИРОК, СЕРЦЯ ТА ЕПІФІЗА / 425

                                                                                                                                                                  

Мелатонін

Шишкоподібна залоза в амфібій містить індол — N-аце-тил-5-метокситриптамін, який називають мелатонін, оскільки він робить світлішою шкіру головастиків, впливаючи на меланофори. Однак він, вірогідно, не відіграє фізіологічної ролі в регулюванні кольору шкіри. Мелатонін і ензими, що відповідають за його синтез з серотоніну шляхом N-ацетилювання і О-метилювання (рис. 24-11), наявні в епіфізарній тканині ссавців, хоча мелатонін синтезують також інші органи. Крім того, мелатонін синтезують епіфі-зарні паренхіматозні клітини і секретують у кров та спинномозкову рідину.

Визначено дві ділянки зв’язування мелатоніну: сайт ML1 з високою спорідненістю і сайт ML2 з низькою спорідненістю.

Триптофан

і

5-Гідрокситриптофан

5-Гідрокситриптамін

(серотонін)

Л/-Ацетилтрансфераза + Ацетил-КоА

О

Н

Л/-Ацетил-5-гідрокситриптамін

(Л/-Ацетилсеротонін)

ГІОМТ +

S-Аденозилметіонін

О

Н

М-Ацетил-5-метокситриптамін

(мелатонін)

6-Гідроксимелатонін (у печінці) та інші метаболіти (у головному мозку)

Рис. 24-11. Утворення та метаболізм мелатоніну; ГІОМТ -гідроксиіндол-О-метилтрансфераза. Детальніше синтез та метаболізм серотоніну показано на рис. 4-22.

Клоновано два підтипи MLl-рецепторів: Mel 1а і Mel lb. Усі рецептори з’єднуються з G-білками, у цьому разі MLl-рецептори інгібують аденілатциклазу, a ML2-рецептори стимулюють гідроліз фосфоінозитиду. Однак сьогодні остаточна функція кожного з них ще не з’ясована.

                                                                                                                                                                  

Регулювання секреції

У людини і всіх біологічних видів, які сьогодні вивчено, синтез і секреція мелатоніну посилюються вночі, а впродовж дня є на низькому рівні (рис. 24-12). Цю значну добову зміну секреції спричинює норадреналін, секретований постгангліонарними симпатичними нервами (вінцевими нервами), які іннервують шишкоподібну залозу (див. рис.

24-10). Норадреналін діє через p-адренергічні рецептори епіфіза, збільшуючи внутрішньоклітинний вміст цАМФ, що, відповідно, призводить до значного посилення активності N-ацетилтрансферази. Це, власне, і зумовлює збільшення синтезу та секреції мелатоніну.

Стимулювання епіфіза симпатичними нервами синхронізоване з циклом зміни світла і темряви за допомогою ретиногіпоталамічних нервових волокон, які проходять до супрахіазматичних ядер. Як саме вони регулюють циркадні ритми, описано в Розділі 14. У напрямі від гіпоталамуса низхідні шляхи перетинаються в інтермедіолатеральних сірих стовпах грудного відділу спинного мозку і закінчуються у прегангліонарних симпатичних нейронах, які, відповідно, іннервують верхній шийний вузол — місце, де починаються постгангліонарні нейрони нервів, що проходять до епіфіза.

Мелатонін, який міститься у крові, швидко метаболізує у печінці шляхом 6-гідроксилювання з наступною кон’югацією, у цьому разі близько 90% мелатоніну, що виділяється з сечею, є у вигляді 6-гідроксикон’югатів і 6-суль-фатоксимелатоніну. Шлях метаболізму мелатоніну в мозку ще не з’ясований, однак може передбачити розщеплення індолового ядра.

Рис. 24-12. Добові ритми вмісту різних сполук в епіфізі та мелатоніну в крові. Затінені ділянки на шкалі часу стосуються темного періоду доби.

Час доби, год

Рис. 24-13. Концентрація мелатоніну в плазмі крові упродовж доби (± стандартна похибка) у чоловіків віком 20-27 (А) і 67-84 (Б) роки (відтворено за дозволом з Turek F: Melatonin type hard to swallow. Nature 1996;379:295).

                                                                                                                                                                  

Функції епіфіза

Мелатонін, уведений парентеральним шляхом, дещо впливає на гонади, проте ці впливи значно відрізняються залежно від біологічного виду, а також залежать від часу, коли зроблено ін’єкцію. В деяких ситуаціях мелатонін пригнічує функцію гонад, а в інших — посилює. Зазначена відмінність привела до припущення, що річ не в самому мелатоніні, а власне у добових коливаннях його секреції. Це може бути правильним, особливо щодо тварин із сезонною циклічністю розмноження, які реагують на зміни тривалості доби. Однак регулювання яких саме процесів відбувається за допомогою цієї системи у людей, наразі не відомо.

Суперечним є питання про те, чи шишкоподібна залоза пригнічує початок статевого дозрівання у людини, оскільки пухлини епіфіза деколи супроводжуються передчасним статевим дозріванням. Проте, як зазначено в Розділі 23, пухлини епіфіза призводять до передчасного статевого дозрівання лише тоді, коли вони вражають гіпоталамус. Нічна концентрація мелатоніну в плазмі крові у дітей значно вища, ніж у дорослих, і з віком вона знижується. У дітей віком один-три роки середня концентрація мелатоніну в плазмі крові становить 250 пг/мл (1080 пмоль/л); у підлітків 8-15 років — у середньому 120; у молодих людей 20-27 років — 70; у старечих осіб віком 67-84 років — у середньому 30 пг/мл (рис. 24-13). Як бачимо, це зниження відбувається поступово упродовж усього життя, без різких змін у період статевого дозрівання; денна концентрація мелатоніну в плазмі крові у всіх вікових категорій становить близько 7 пг/мл. Отже, функції шишкоподібної залози і мелатоніну у людини ще до кінця не з’ясовані.

                                                                                                                                                                  

ЛІТЕРАТУРА ДО ЧАСТИНИ IV: ЕНДОКРИННА СИСТЕМА, МЕТАБОЛІЗМ І РЕПРОДУКТИВНА ФУНКЦІЯ

Adashi EY, Hennebold JD: Single gene mutations resulting in reproductive dysfunction in women. N Engl J Med 1999; 340:709.

Andersson K, Wagner G: Physiology of penile erection. Physiol Rev 1995;75:191.

Bagatell CJ, Bremner WJ: Androgens in men: Uses and abuses. N Engl J Med 1996;334:707.

Baumann G: Growth hormone binding proteins. Proc Soc Exper Biol Med 1993;202:392.

Bilezikian JP, Raisz LG, Rodan GA: Principles of Bone Biology. Academic Press, 1996.

Bole-Feysot C et al: Prolactin (PRL) and its receptor: Actions, signal transduction pathways, and phenotypes observed in PRL receptor knockout mice. Endocr Rev 1998; 19:225.

Bouillon R: The many faces of rickets. N Engi J Med 1998;338: 681.

Braverman LE, Utiger RD (editors): Werner and Ingbar s The Thyroid: A Fundamental and Clinical Text, 7th ed. Lippin-cott-Raven, 1996.

Brzezinski A: Melatonin in humans. N Engl J Med 1997;336: 186.

Corvol P, Jeunemaitre X: Molecular genetics of human hypertension: Role of angiotensinogen. Endocr Rev 1997; 18: 662.

Diaz MN et al: Antioxidants and atherosclerotic heart disease. N Engl J Med 1997;337:408.

Dunne MI, Aynsley-Green A, Lindley KI: Nature’s KATP-channel knockout. News Physiol Sci 1997; 12:197.

Dwyer JT: Nutritional consequences of vegetarianism. Annu RevNutr 1991; 11:61.

Eastell R: Drug therapy: Treatment of postmenopausal osteoporosis. N Engl J Med 1998;338:736.

Eisan LJ, Longo M: Glucose transporters. Annu Rev Med 1992;43:377.

Falkner F, Tanner JM (editors): Human Growth, 2nd ed. 3 vols. Plenum, 1986.

Fisher JW: Erythropoietin: Physiologic and pharmacologic aspects. Proc Soc Exper Biol Med 1997;216:358.

Francomano CA: Clinical implications of basic research: The genetic basis ofdwarflsm. N Engl J Med 1995;332:58.

Frawley LS, Boockfor FR: Mammosomatotropes: Presence and functions in normal and neoplastic pituitary tissue. Endocr Rev 1991; 12:337.

ЕНДОКРИННА ФУНКЦІЯ НИРОК, СЕРЦЯ ТА ЕПІФІЗА / 427

Frohman LA, Downs TR, Chomczynski P: Regulation of growth hormone secretion. Front Neuroendocrinol 1992; 13: 344.

Gehlert DR: Multiple receptors for the pancreatic polypeptide (PP-fold) family: physiological implications. Proc Soc Exper Biol Med 1998:218:7.

Gerich JE: Oral hypoglycemic agents. N Engi J Med 1989; 321:1231.

Goodfriend TL, Elliott ME, Catt KJ: Angiotensin receptors and their antagonists. N Engl J Med 1996;334:1649.

Hackenthal E et al: Morphology, physiology and molecular biology of renin secretion. Physiol Rev 1990;70:1067.

Heaning VJ, Tsukamato K: Enzymatic control of pigmentation in mammals. FASEB J 1991;5:2902.

Himms-Hagen J: Neural control of brown adipose tissue thermogenesis, hypertrophy, and atrophy. Front Neuroendocrinol 1991; 12:38.

Hruska KA, Teitelbaum SL: Renal osteodystrophy. N Engl J Med 1995;333:166.

Inagami T: A memorial to Robert Tiegerstedt: The centennial of renin discovery. Hypertension 1998;32:953.

Kim S, Iwao H: Molecular and cellular mechanisms of angiotensin ІІ-mediated cardiovascular and renal diseases. Pharmacol Rev 2000;52:11.

Knobil E, Neill JD (editors): The Physiology of Reproduction, 2nd ed. 2 vols. Raven Press, 1994.

Knopp RH: Drug treatment of lipid disorders. N Engl J Med 1999;341:498.

Komers R, Vrana A: Thiazolidinediones — tools for the research of metabolic syndrome X. Physiol Res 1998;47:215.

Kuiper GGJM et al: The estrogen receptor (3: a novel mediator of estrogen action in neuroendocrine systems. Front Neuroendocrinol 1998; 19:253.

Lacy PE: Treating diabetes with transplanted cells. Sci Am (July) 1995;273:50.

Lazar MA: Recent progress in understanding thyroid hormone action. Thyroid Today 1997 (Oct);20:l.

Lee MM, Donahue PK: Mullerian inhibiting substance: A gonadal hormone with multiple functions. Endocr Rev 1993; 14:152.

LeRoith D: Insulin-like growth factors. N Engl J Med 1997; 336:633.

LeRoith D, Olefsky JM, Taylor SI (editors): Diabetes Mel-litus. Lippincott-Raven, 1996.

Levin ER, Gardner DG, Samson WK: Natriuretic peptides. N Engl J Med 1998;339.

Maack T: Receptors for atrial natriuretic factor. Annu Rev Physiol 1992;54:11.

Marcus R, Hoffman AR: Growth hormone as treatment in older men and women. Annu Rev Pharmacol Toxicol 1998;38:45.

Martin JB, Reichlin S: Clinical Neuroendocrinology, 2nd ed. Davis, 1987.

Mather JP, Moore A, Li R-H: Activins, inhibins, and follis-tatins: Further thoughts on a growing family of regulators. Proc Soc Exper Biol Med 1997;215:209.

Medeiros-Neto G: Clinical and molecular advances in inherited disorders of the thyroid system. Thyroid Today 1996 (July); 19:1.

Melmed S (editor): The Pituitary. Blackwell, 1994.

Mendelsohn ME, Kavas RH: The protective effects of estrogen on the cardiovascular system. N Engl J Med 1999;340:1801.

Money J: The Kaspar Hauser Syndrome of “Psychosocial Dwarfism Deficient Structural, Intellectual, and Social Growth Induced by Child Abuse. Promethius Books, 1994.

Moore CCD, Grumbach MM: Sex determination and go-nado-genesis: A transcription cascade of sex chromosome and autosome genes. Semin Perinatol 1992; 16:226.

Naz RK (editor): Endocrine Disrnptors. CRC Press, 1998.

Nelson RJ: Behavioral Endocrinology. Sinauer, 1994.

Norwitz ER, Robinson JN, Challis JRG: The control of labor. N Engl J Med 1999;341:660.

Philipson LH, Steiner DH: Pas de deux or more: The sulfonylurea receptor and K+ channels. Science 1995;268: 372.

Plant TM, Lee PA (editors): The Neurobiologу of Puberty. Society for Endocrinology, 1995.

Prockop D: Mutations in collagen genes as a cause of connective tissue disease. N Engl J Med 1992;326:540.

Refetoff S, Weiss RE, Usala SJ: The syndromes of resistance to thyroid hormone. Endocr Rev 1993; 14:348.

Reisine T, Bell GI: Molecular biology of somatostatin receptors. Endocr Rev 1995;16:427.

Roife DFS, Brown GC: Cellular energy utilization and molecular origin of standard metabolic rate. Physiol Rev 1997; 77:731.

Rosenbaum M, Leibel RL, Hirsch J: Obesity. N Engl J Med 1997;337:396.

Schwartz RS: The new immunology — the end of immunosuppressive drug therapy? N Engl J Med 1999;341:754.

Shils ME, Young VR (editors): Modern Nutrition in Health and Disease, 7th ed. Lea & Febiger, 1987.

Stocco DM: A review of the characteristics of the protein required for the acute regulation of steroid hormone biosynthesis: the case for the steroidogenic acute regulatory (StAR) protein. Proc Soc Exp Biol Med 1998;217:123.

Strewler GL: The physiology of parathyroid hormone-related protein. N Engl J Med 2000;342:177.

Strugnell SA, Deluca HF: The vitamin D receptor-stmcture and transcriptional activation. Proc Soc Exper Biol Med 1997;215:223.

Trieman K et al: IUDS: An update. Popul Rep В 1995;6:1.

Veenstra TD, Pittleikow MR, Kumar R: Regulation of cellular growth by 1,25-dihydroxy vitamin D3-mediated growth factor expression. News Physiol Sci 1999; 14:37.

Voipe R: Autoimmune Endocrinopathies. Humana Press, 1999.

Walker WH et al: The human placental lactogen genes: Structure, function, evolution, and transcriptional regulation. Endocr Rev 1991; 12:316.

Waterman MR, Bischof LJ: Diversity of ACTH (cAMP)-de-pendent transcription of bovine steroid hydroxylase genes. FASEB J 1997; 11:419.

Wehling M: Specific, nongenomic actions of steroid hormones. Annu Rev Physiol 1997;59:365.

Weiner S, Traube W: Bone structure: from angstroms to microns. FASEB J 1992;6:879.

Weintraub BD (editor): Molecular Endocrinology. Raven Press, 1994.

Weiss G: The physiology of human relaxin. Contrib Gynecol Obstet 1991; 18:130.

Welch GN: Mechanisms of disease: Homocysteine and athero-thrombosis. N Engl J Med 1998;4338:1042.

White PC: Disorders of aldosterone biosynthesis and action. N Engl J Med 1994;331:250.

Willett WC: Diet and health: What should we eat? Science 1994;264:532.

Willett WC, Dietz WH, Colditz GA: Guidelines for healthy weight. N Engl J Med 1999;341:427.

Wilson JD et al (editors): Williams Textbook of Endocrinology, 9th ed. Saunders, 1998.

Wilson JD, Griffin JE, Russell W: Steroid 5a-reductase 2 deficiency. EndocrRev 1993; 14:577.

Yanase T, Simpson ER, Waterman MR: 170-Hydroxylase/ 17,20-lyase deficiency: From clinical investigation to molecular definition. Endocr Rev 1991; 12:91.

Yen, SSC, Jaffe RB, Barbieri RL: Reproductive Endocrinology: Physiology, Pathophysiology, and Clinical Management, 4th ed. Saunders, 1999.

Вільям Ф. Ґанонґ. Фізіологія людини